PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03508.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 175aa    MW: 19378.9 Da    PI: 9.5237
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03508.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.24.3e-3959117260
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                              ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k 
  Rsa1.0_03508.1_g00001.1  59 PDKIIACPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKAKP 117
                              68999***************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2958116IPR003851Zinc finger, Dof-type
PfamPF027013.9E-3261116IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.01563117IPR003851Zinc finger, Dof-type
PROSITE patternPS01361065101IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MASQDSQGIK LFGKTITFNA GNLTHTIKKE EQQQQPEIQT KPAARSPSSS SDLTAEKRPD  60
KIIACPRCKS METKFCYFNN YNVNQPRHFC KGCQRYWTAG GALRNVPVGA GRRKAKPPGR  120
VGGFAELLGD ATGTIDQVEL DALLVEEWRA AASHGGYRHD FPVKRLRCYT DGQSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0210431e-151AC021043.4 Arabidopsis thaliana chromosome I BAC F28N24 genomic sequence, complete sequence.
GenBankBT0299901e-151BT029990.1 Arabidopsis thaliana At1g29160 mRNA, complete cds.
GenBankCP0026841e-151CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626298.11e-111PREDICTED: dof zinc finger protein DOF1.5-like
SwissprotP683501e-105DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBLA0A078DLL81e-111A0A078DLL8_BRANA; BnaA08g18130D protein
STRINGBra010848.1-P1e-108(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28092669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.11e-103Dof family protein